<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33846
Description |
Uncharacterized protein |
Sequence | MDTSTPSNLMDKHQKIISEILRSYRDLINCVTVNGMDKEKPGDYEAQANKLNFRDPDVMAAAGLRTQRKFDELYESIKELLALTRTIKELWVFGPVDRADEHRKQKEAQIDRDVAEITTLFNKIDANAMRDLAEKNGGTWEPQGEAALTAPAAQAPTGN |
Length | 159 |
Position | Head |
Organism | Gibberella moniliformis (strain M3125 / FGSC 7600) (Maize ear and stalk rot fungus) (Fusarium verticillioides) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium>
Fusarium fujikuroi species complex.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.691 |
Instability index | 18.87 |
Isoelectric point | 5.14 |
Molecular weight | 17862.91 |
Publications | PubMed=20237561
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP33846
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 34.62| 10| 16| 107| 116| 1
---------------------------------------------------------------------------
107- 116 (17.08/10.68) EAQIDRDVAE
125- 134 (17.54/11.12) DANAMRDLAE
---------------------------------------------------------------------------
|