<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33836
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MDDVLNEQFGRVERALTTLVDSIAAYNPATQAAIDLVAADDQLSDGLDQLARHQANHGRIQALRAEADALEAQLRDSVRKLAELRRELFNTPATTFPPESRAVPFDELLQYATNISRYTVPPTYRERVPTTDKDDDDVGSSGAPTNGMNTPAIVPDAVDLPNDSSEAQKAGEDADGAVPDITAEEEEWLRKLKASNLAWYPWPSTDKIRNGILYRLSYWREKGNDLDQFDIPAYLEEQRKKALGNEASLEETPAEPTEEQPHREAARPTRPLSAFTGLDDMDEM |
| Length | 284 |
| Position | Middle |
| Organism | Bipolaris oryzae ATCC 44560 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Bipolaris.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.739 |
| Instability index | 39.09 |
| Isoelectric point | 4.43 |
| Molecular weight | 31608.36 |
| Publications | PubMed=23357949
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33836
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.99| 23| 23| 134| 156| 1
---------------------------------------------------------------------------
134- 156 (42.20/26.30) DDDDVGSSGAPTNGMNTPAIVPD
158- 180 (39.79/24.39) VDLPNDSSEAQKAGEDADGAVPD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 76.36| 22| 23| 83| 104| 2
---------------------------------------------------------------------------
83- 104 (40.26/27.94) ELRRELFNTPATTFPPESRA.VP
107- 129 (36.09/24.31) ELLQYATNISRYTVPPTYRErVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.36| 23| 30| 29| 51| 4
---------------------------------------------------------------------------
29- 51 (37.05/23.33) ATQAAID.LVAADD....QLSDGLDQLA
55- 82 (28.31/16.30) ANHGRIQaLRAEADaleaQLRDSVRKLA
---------------------------------------------------------------------------
|