Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MPPPLPPPDEQEFDQPQLIGGLPTPDLHAGNNLFWYFTSSPWFDSECINIDVYLNLRQNDPAVAEKIMNDPKLWQQRLDDQSEGTQYVIAGEGQGEGHPWLLQRQHKVRVTENDKERIENFVEGNWYTHGTKMLMAPSLLDIVQSRMLTVSTRMQQMAELSKNMTHWTPATGYSYFPSSYETAKATTTASRVGSPTLAPTDADAPGSQSQGAGVAAQATDSAASATDFSDALFMHSLNLTNAYGDEYMDENPLKGEPGAFVFEGTKTAVTARNKAQEQQSIQAVQPAPAAPTELKIDTATPSVAPSVVATPKAVATPGAMEGHSRKSSVAPGSKKKKDRRKSQAGLASPTTPSVPQA |
Length | 357 |
Position | Head |
Organism | Bipolaris oryzae ATCC 44560 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Bipolaris. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.589 |
Instability index | 52.09 |
Isoelectric point | 5.23 |
Molecular weight | 38645.61 |
Publications | PubMed=23357949 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33834 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 58.29| 17| 20| 120| 136| 1 --------------------------------------------------------------------------- 120- 136 (33.25/24.98) NFVEGNWYTHGTKM.LMA 141- 158 (25.04/17.15) DIVQSRMLTVSTRMqQMA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 45.07| 15| 16| 190| 204| 2 --------------------------------------------------------------------------- 190- 204 (26.01/13.52) SRVGSPTLAP..TDADA 207- 223 (19.06/ 8.11) SQSQGAGVAAqaTDSAA --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 114.67| 35| 59| 257| 291| 3 --------------------------------------------------------------------------- 257- 291 (59.43/37.05) PGAFVFEGTKTAVT.ARNKAQEQQSIQAVQPAPAAP 317- 352 (55.23/33.93) PGAMEGHSRKSSVApGSKKKKDRRKSQAGLASPTTP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GAMEGHSRKSSVAPGSKKKKDRRKSQAGLAS 2) LKIDT | 318 294 | 348 298 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab