Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MSSQADQQSATDTTQQADNAISAEKSSEELKTYRQIAAEHIDTLNEINHQIPKLLKYFATALSQLTNDPIPFQHDAMQCEPGTLEARKEAFRINALFCGTSCEIIRQELVKQINALERYKVIPKSHPKFAVTQSQARKGKEEESEVVDPEKDVKNGGYGDFDVGVLNARASSGQVGAEDVLDRARAILQELQKRTEGATNADDMVMDE |
Length | 208 |
Position | Head |
Organism | Bipolaris oryzae ATCC 44560 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Bipolaris. |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.665 |
Instability index | 36.31 |
Isoelectric point | 4.91 |
Molecular weight | 23069.40 |
Publications | PubMed=23357949 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33826 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 98.84| 30| 69| 34| 64| 1 --------------------------------------------------------------------------- 34- 64 (47.00/35.84) RQIAAEHIDTLnEINHQIPKLLKYFATALSQ 106- 135 (51.84/34.69) RQELVKQINAL.ERYKVIPKSHPKFAVTQSQ --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) GYGDFDVGVLNARAS 2) QVGAEDVLDRARAILQELQKRTE | 157 174 | 171 196 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab