<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33823
Description |
Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MKYSGLYFISNPSTSVEAALSTITTLTQSIESTFQTATRQQPWSLSYRAFRDVIPPGYTPPTGADGKPAPYPHSYQHMLHLSTLAPTRTYIYAQPAAQPATTASIPLRQQEAHASMLRNQSSALWAQRHVFSVRDGTTYTAGLCTIQLGELRATREGPQSGAMLSPGIILCITTLVGAEDADEGPDAAYAAVENGAPLDAVEQGDVDFEYAQKVIRECWGRIKEGRDLGRSEVREFMMAARVEVKRELQRDQAVHMWCDALRIRG |
Length | 265 |
Position | Head |
Organism | Bipolaris oryzae ATCC 44560 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Bipolaris.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.350 |
Instability index | 42.54 |
Isoelectric point | 6.08 |
Molecular weight | 29180.57 |
Publications | PubMed=23357949
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP33823
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 81.28| 24| 24| 136| 159| 1
---------------------------------------------------------------------------
136- 159 (42.99/29.82) GTTYTAG..LCTIQLGELRATREGPQ
161- 186 (38.29/25.82) GAMLSPGiiLCITTLVGAEDADEGPD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 92.02| 26| 31| 58| 84| 2
---------------------------------------------------------------------------
58- 84 (46.76/28.44) YTPPTGADGKPAPYPHSYQHMlHLSTL
92- 117 (45.25/23.56) YAQPAAQPATTASIPLRQQEA.HASML
---------------------------------------------------------------------------
|