<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33807

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMPGILIMNHTASDAATASRHGDSNTAAPNGASAASTALDKYSQLPPEIAHIGPEQYNALSTLLQRVSQESYNDLTSILQKMAALPVAPMANGALPNGLGAANMQGNAESNKRKKLMLLQFAQEQRSKFIKLLVLTEWGKKAASDISKLIDIFSWAGAHARNMDAADDQLERIKMLSNIARENNPDIATALQVLSTGKASWMPSLDYIPPKPISSDEALKLLRYMNTSLSIRLNVHENLPRHLRNWRIHSGRVTFTIKGQLEFDVMSFVEDASEQWFLIDLRLLFTPAPTVTVGSRFFIQLKQQADFVLKDKGLPGLFEFLNNFILTHKISVLRSQAAALVRAGWAGSLKVEPVHRLLVVQYWTTKPGKKNWIEIGVSNNRLSNAKSSWRGPPIPSLTTRWFRQGREVKDANFAFDWTNLSMEKVIKLVIARHTSDILRSTKESMKSGVVAETDLSEAEPGDCRLNATLGTKSASITLSLEPVTGNHIMRPASALSARAENAFNLGREPAQMAHVMTQVLAGTLLGLIQRNAQQLGWQTVARQSLTPQMVKAAVKLDVISSVLYWPRGWSPNWAFAAIIDASGESWWVLEIGSSGNRVEHAEQIRMNRPDKSPLPINRSTLASLERVAVQLLSFRVTARQLEKEKKMYALEEELGQTPASAQGRRIARRWVLRVQTPDLLTPSTRDDKWLEADIKITCEGLRVGGQEVWHVASGKMVKSVAADMHKLMAASPQKAFKFSDDGNFRILLSTPFGQDILGELRARLRDVNRLRSFATTLQKRRMRLASSSLQRVQFFYGPSPYTATVNFSSEKEVTIELSSKNPHHRILNLLTHIANDRLPSFMSLDRNDANGLDRFCTTLVLTRPLFKVFREIEQRSPGNCRNPAIHVHSILKYRITYENPVCTFDVCLQPKDDKVFWFVEDNLRPKDPNVLPTPERGQGHRRLDNLQEKLKELFSSKGPGWFGTRNGMVAELDAIPDALRKLDECVLSCKMEGGYVAPPPLERPTQQAQNPGQGMSKTNGVQQGSQQQHQHQQQQQQHQHQQHQARMQQQQQQQHQARQQQQGQQQMRMQQSNQRVQQPNGRQPQHMQNARQHMQHQQGRGGRPGQTQNNVIEID
Length1114
PositionTail
OrganismBipolaris zeicola 26-R-13
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Bipolaris.
Aromaticity0.06
Grand average of hydropathy-0.495
Instability index48.20
Isoelectric point9.79
Molecular weight125219.42
Publications
PubMed=23357949

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU365082
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP33807
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      86.87|      16|      16|    1030|    1045|       1
---------------------------------------------------------------------------
 1030- 1045 (34.58/18.67)	HQQQQQQHQ...HQQHQAR
 1047- 1065 (27.58/13.26)	QQQQQQQHQarqQQQGQQQ
 1066- 1081 (24.70/11.03)	MRMQQSNQR...VQQPNGR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.59|      16|      16|     130|     145|       2
---------------------------------------------------------------------------
  113-  128 (23.21/10.27)	KKLMLLQFAQEQRSKF
  130-  145 (26.38/12.54)	KLLVLTEWGKKAASDI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      54.93|      17|      19|     262|     280|       4
---------------------------------------------------------------------------
  262-  280 (24.30/27.21)	FDVMSFVEDASEqwFLIDL
  284-  300 (30.63/23.03)	FTPAPTVTVGSR..FFIQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.43|      18|      21|     920|     940|       7
---------------------------------------------------------------------------
  920-  937 (34.28/17.34)	DNLRPKDPNVLPTPERGQ
  943-  960 (29.16/19.41)	DNLQEKLKELFSSKGPGW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.81|      17|     148|     383|     399|      11
---------------------------------------------------------------------------
  383-  399 (32.27/15.27)	NAKS.SWRGPPIPSLTTR
  530-  547 (26.55/11.43)	NAQQlGWQTVARQSLTPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      51.99|      11|      16|     835|     845|      15
---------------------------------------------------------------------------
  835-  845 (18.27/ 9.84)	DRLPSFMSLDR
  852-  862 (17.83/ 9.44)	DRFCTTLVLTR
  863-  873 (15.89/ 7.69)	PLFKVFREIEQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.56|      17|      19|     756|     772|      17
---------------------------------------------------------------------------
  756-  772 (28.12/18.92)	LGELRARL..RDVNRLRSF
  776-  794 (24.43/15.39)	LQKRRMRLasSSLQRVQFF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP33807 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) GGYVAPPPLERPTQQAQNPGQGMSKTNGVQQGSQQQHQHQQQQQQHQHQQHQARMQQQQQQQHQARQQQQGQQQMRMQQSNQRVQQPNGRQPQHMQNARQHMQHQQGRGGRPGQTQNNVIEID
992
1114










Molecular Recognition Features






MoRF SequenceStartStop




NANANA