<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33802

Description Mediator of RNA polymerase II transcription subunit 16
SequenceMDGASYNMDVDDLFGDSEHVNIQTINTTPPAKGRDARIDELGSTGCCQKISWSKNGCVAYITPDGYSVNLKIFSRNPETGKWALGKTVPLELPQGSEVFPLIHLSWSHLGNDLAVMDQAGRVMIFSCAMALDRMHFTRAEIAHPESEVDAVVGMHWLAILPYAQKNLIAWSAAREGNKWKWNIRQHLFNNAHHPVDGKASLIYLKRYGELKLRFQQNDNNWQEASAQLGPMISTKESFTHAAFASNNDNTLLLAAYDVKRRLHLYRVETIWNVPADKRSQNAGPFEKPTIQVSLLALEDTCNPVDMANDELSNGGTSESAATAAAQLTHLDFLPVTPQQDDGSVPTVQAIFSRPPNPISYDMNPQETRYSIIVKWQVHQEQQNQLHPSLEQVTSKKKSVSSLPAQTAFLLKRQPDFALHSVVLDFYPMWYNMLLAFCYSDGSIEFRKRSTMEVIMPDDNTDNVTSLLQAGFVFQHAEPSLHVAFSPNHCVAVGMQLDGTTKLRLMEYTHGTLSSDDDDPHHSAALAALILQSSSAANQYFSSDDIFAIIDSMSDKRKQDFITLLFEGLQVNIDCGIDDSSTNHFILLGRSPFFVKTLSAMHLLGLQGTINRTLVSKTAWQILNIKYVTQILTTIVRMHGDVSKINLRPEAVPQMIGTIRWTMHFMAYILDDLFALGRALSDIPPADLTRDILESKIKETNKPAILLLLSAFPRAMMKLWAQPIQWVKRSAESQAATSNPAGGPVPVQSPESKKLYTPLLSAVSELPFEWRWFEVLVTETTAHIRAIYKQRNLNDAQRNSIEREILLGKIPDILFPVAKRLVTDTLWNSNQQNACLADKLDMGKLMFFDTTWLGFTDSKRARLWHDEHVVDVCQKMIIRGIGTWVHPVNTSGHHLMGRGRSDSLQSAAGGTGASAAGGATANGESGSDRKGRNMLRQCVRCGACMEDVVPGLQGYTIHHYQWLVGVSKHCVCGNSWMLVETKPSLR
Length985
PositionTail
OrganismBipolaris zeicola 26-R-13
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Pleosporomycetidae> Pleosporales> Pleosporineae> Pleosporaceae> Bipolaris.
Aromaticity0.08
Grand average of hydropathy-0.236
Instability index44.51
Isoelectric point6.45
Molecular weight109867.00
Publications
PubMed=23357949

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP33802
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     121.26|      34|     101|     256|     289|       3
---------------------------------------------------------------------------
  256-  289 (60.25/50.43)	YDVKRRLHLYRVETIWNVPADKRSQNAGPFEKPT
  360-  393 (61.02/51.19)	YDMNPQETRYSIIVKWQVHQEQQNQLHPSLEQVT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.51|      18|     653|      85|     102|       9
---------------------------------------------------------------------------
   85-  102 (31.97/21.36)	GKTVPLELPQGSEVF.PLI
  741-  759 (28.54/18.26)	GGPVPVQSPESKKLYtPLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.45|      21|     591|     303|     324|      17
---------------------------------------------------------------------------
  303-  323 (36.81/21.02)	PVDMANDELSNGGTSESAATA
  886-  906 (36.64/16.48)	PVNTSGHHLMGRGRSDSLQSA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP33802 with Med16 domain of Kingdom Fungi
Unable to open file!