Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MAPVTLKTVDDDLKDVIQHLFEIQSAVHGYLGPETQQELVRKIKNLTLALSTLSTHTQLSPTQETQPDTNTDPSNPSLASIQLPPEIIDYVDSARNPDIYTREFVELVQRGNQDLRGKREAFASFRDVLAREMRSAMPECRSEVDRVVAATGGAVDGSGGVAEDAAMSGSGN |
Length | 172 |
Position | Middle |
Organism | Penicillium roqueforti (strain FM164) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes> Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.434 |
Instability index | 36.69 |
Isoelectric point | 4.68 |
Molecular weight | 18696.60 |
Publications | PubMed=24407037 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33791 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 74.81| 22| 27| 28| 49| 1 --------------------------------------------------------------------------- 28- 49 (38.66/25.30) HGYLGP..ETQQELVRKIKNLTLA 56- 79 (36.16/23.28) HTQLSPtqETQPDTNTDPSNPSLA --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) IYTRE 2) SLASIQLPPEIIDYVDSAR | 99 77 | 103 95 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab