<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33786
Description |
Mediator of RNA polymerase II transcription subunit 21 |
Sequence | MADILTQLQTCLDQLATQFYATLGYLTTYHDNAPTTPPPNVPDAAPALAKMAKNSSSPPVPAAVANKVGGAAVVAGNASPPLAPPQQPGAAPGTAPEGGDPNLPPAPDSPSTFASRQRELARDLIIKEQQIEYLISVLPGIGASEAEQESRIRELETELRDVEKERAAKVRELRKLRTRLEDVLGAVAVGIHGDGYSQN |
Length | 199 |
Position | Middle |
Organism | Penicillium roqueforti (strain FM164) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Eurotiomycetes>
Eurotiomycetidae> Eurotiales> Aspergillaceae> Penicillium.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.362 |
Instability index | 64.21 |
Isoelectric point | 4.99 |
Molecular weight | 20962.34 |
Publications | PubMed=24407037
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP33786
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 90.28| 19| 20| 70| 88| 1
---------------------------------------------------------------------------
47- 65 (28.34/11.17) ALAKMAKNSSSPPVP.AAVA
70- 88 (34.68/15.22) GAAVVAGNASPPLAP.PQQP
93- 110 (27.25/10.48) GTAPEGGD..PNLPPaPDSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 98.46| 33| 50| 114| 149| 2
---------------------------------------------------------------------------
114- 149 (44.07/41.90) ASRQRELaRDLIIKEQQIeyLISVLPGIGASEAEQE
167- 199 (54.38/38.14) AAKVREL.RKLRTRLEDV..LGAVAVGIHGDGYSQN
---------------------------------------------------------------------------
|