<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33775
| Description |
Cyclin domain containing protein |
| Sequence | MAGNFWQSSHYDQWIFEKQELLRMRSEDLKIYTEEEYQKLMIFWANLIQTLAVEGIQQGHPKTRMQVIATAIVYFKRFYARRSYKDVDPLLIACASVFLASKVEEHGLMSMSNLIKTIPNCLKKWPNLTYDASSKNSGLYDAEFILVEMLDCCLVVYHPYRPLTTMLQDIARDPTVKDMAPFEEQCWKVANDSLRSDCSLLYPPHIIAIASIIVGAELMNREKDIKMWLPELSVDFEKVYDCVNTIFAMYKTWKTFDEKEHVKPLFDKLPKINPGPTF |
| Length | 278 |
| Position | Kinase |
| Organism | Haemonchus contortus (Barber pole worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Strongylida>
Trichostrongyloidea> Haemonchidae> Haemonchus.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.176 |
| Instability index | 47.30 |
| Isoelectric point | 5.92 |
| Molecular weight | 32436.38 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33775
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.91| 9| 44| 151| 160| 2
---------------------------------------------------------------------------
151- 160 (17.43/15.07) DCCLvVYHPY
197- 205 (20.48/12.46) DCSL.LYPPH
---------------------------------------------------------------------------
|