<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33770
Description |
Uncharacterized protein |
Sequence | MSASYWCSSQRQKWQYTRDQLTRIRADLGDNCNVHNRIFLHSLIVKLGGKLNLRQVILSTAEVFLNRFLTRATLKEVNAYLLVTTCIYLGCKIEESPVHIRNIVNESRNAWPEFIPSDPTKLAEFEFYLIEEMDCYMVIHHPYNSLVQIVQVLKTGDFKVGITSDEQKIAWSIVNDSYITDLPLLFPPHITAIAAVYMACILMDDNIYKNQRVNSFIKFLAVSNVDLDEVIEAVQEMLTLYENWNGYDEISIRNSLNFRILSLNNA |
Length | 266 |
Position | Kinase |
Organism | Kuraishia capsulata CBS 1993 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetales incertae sedis> Kuraishia.
|
Aromaticity | 0.11 |
Grand average of hydropathy | -0.009 |
Instability index | 41.46 |
Isoelectric point | 5.54 |
Molecular weight | 30767.05 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:EnsemblFungi
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:EnsemblFungi
RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:EnsemblFungi
|
GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by galactose GO:0000411 IEA:EnsemblFungi
positive regulation of transcription from RNA polymerase II promoter involved in meiotic cell cycle GO:0010673 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP33770
No repeats found
No repeats found
|