Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MDANSPLDELQWKSPEWINAFGLRTDNVLEYFSQSPFFDRTANNQVLKMQSQFNEQLQNMSPENIAQELKKMKGVEFVVASVREPDFWIIRKQNRTSPTETQPLADYYIIGSSVYMSPAVSSIISSRLLSTVLSLRNSLNILQTLPKFSPSEGHNYNVNIAEGASAVGHPSLLPSKTVTISSTPMVSSGSVAGSNAGFTGNATVSQMVGSTSSTATSATTFNNLLNLSMADNTVYLEDLPLAGVDPTQGTSNLAPPGTTRAKVDSSRVQYSKKPVAR |
Length | 277 |
Position | Head |
Organism | Kuraishia capsulata CBS 1993 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetales incertae sedis> Kuraishia. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.283 |
Instability index | 58.33 |
Isoelectric point | 6.15 |
Molecular weight | 30007.32 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 PIRNR:PIRNR013286 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33769 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 92.28| 28| 46| 8| 36| 1 --------------------------------------------------------------------------- 8- 36 (48.75/41.11) DELQWKSPEWInAFGLRTDNVLEYFSQS...P 55- 85 (43.54/31.03) EQLQNMSPENI.AQELKKMKGVEFVVASvreP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 194.31| 55| 93| 128| 184| 3 --------------------------------------------------------------------------- 89- 126 (33.85/15.17) .............IIRKQN..RTSPTETQPLADYYIIGSSVYMSPavsSIISS......... 128- 184 (85.73/55.42) LLStvLSLRNSLNILQTLP..KFSPSEGHNYNVNIAEGASAVGHP...SLLPSKTVTISSTP 224- 274 (74.74/42.82) LLN..LSMADNTVYLEDLPlaGVDPTQGTS...NLAPPGTTRAK......VDSSRVQYSKKP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FWIIRK 2) LADYYII | 87 104 | 92 110 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab