Description | Mediator of RNA polymerase II transcription subunit 20 |
Sequence | MVTAVLFVQNAAPNSITQFHDLISNELPVPLGPWSFDLKIFLNNKYSKPSNIHPSQVPNRYLYSLQLSYLPQKTITIINNTKSITTVTSLTANVSEKGSEVSNSKDSKDVSNSKNAKLKEHFLKGCSLNTTTDSFDLFVMNKLQNLWALKQVIKGESGYGYLINVANINSEDSARGHETFKIRTSNCFLHGTFKGFLIEIEHIETTASEEAQNIIMSFSKSISKIKTLIEVYKFPQGRLCFNVLSDSKLDYESDLCQQYSDALQF |
Length | 265 |
Position | Head |
Organism | Kuraishia capsulata CBS 1993 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes> Saccharomycetales> Saccharomycetales incertae sedis> Kuraishia. |
Aromaticity | 0.10 |
Grand average of hydropathy | -0.267 |
Instability index | 39.07 |
Isoelectric point | 7.66 |
Molecular weight | 29800.49 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364152 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33764 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 70.33| 23| 24| 87| 109| 2 --------------------------------------------------------------------------- 78- 96 (23.17/14.23) ....INNTKSITTVT.SLTANVSE 97- 120 (32.01/22.53) KGSEVSNSKDSKDVSnSKNAKLKE 124- 136 (15.14/ 6.69) KGCSLNTTTDSFD........... --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 47.67| 14| 33| 160| 173| 3 --------------------------------------------------------------------------- 160- 173 (23.92/18.49) GYLINVANINSEDS 195- 208 (23.75/18.31) GFLIEIEHIETTAS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) RYLYSLQL 2) WSFDLKIFLNNKY | 60 34 | 67 46 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab