<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33758
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MSCVNKIFTRKYTTFIGSLLSARSEELWCVSIPRQVVLLVCIPMEEDTSVISALYPPPPPYVKCFTDENVGRLRSLLKENGGDLERLDVENTELQFLVPPQQPSGPSYRSFGDIWNFKDKFMTLEDAGIPQLYDGGSTGNGAGDDGEDEEIFTRERIDELKKLAKSLLLNFLELLGIFAKNPEYAKEKISQIRILLINLHHLLNSYRLHQSREILILKIEEKISQDTEEIENIEEVCRSVEEKIRTLVRDRIDSKVKATDGDVDMDEVLPEQTKEQIRELEKQAVKDILANEGNDSH |
| Length | 297 |
| Position | Middle |
| Organism | Kuraishia capsulata CBS 1993 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetales incertae sedis> Kuraishia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.438 |
| Instability index | 51.51 |
| Isoelectric point | 4.78 |
| Molecular weight | 33912.15 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33758
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.94| 27| 31| 165| 191| 1
---------------------------------------------------------------------------
165- 191 (44.53/29.83) KSLLLNFLELLGIF..AKNPEY....AKEKISQ
193- 225 (35.41/22.41) RILLINLHHLLNSYrlHQSREIlilkIEEKISQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.27| 21| 30| 241| 262| 3
---------------------------------------------------------------------------
241- 262 (29.13/26.33) EEKIRTLVRDRIDsKVKATDGD
274- 294 (33.14/24.42) KEQIRELEKQAVK.DILANEGN
---------------------------------------------------------------------------
|