<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33748
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MAADKSTKEKLLSALNDIEVLSRELVEMLALSRSQKLPQPGEDTQVLELLVQRDKEFQELMRTALRQGRTHEEMQKLEKEVEKRDGDIQLLQKQLKEAEHILATAVYQAKEKLKSIEKARKGSISSEEIIKYAHRISASNAVCAPLNWVPGDPRRPYPTDLEMRSGMLGHMCNLPTNGVNGHLPGDALAAGRLPDVLAPQYPWQSADVAMAMPPPPHHGNDLGLELPGHNKENEDDVEAMSTDSSSSSSDSD |
| Length | 252 |
| Position | Middle |
| Organism | Ictalurus punctatus (Channel catfish) (Silurus punctatus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Siluriformes>
Ictaluridae> Ictalurus.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.660 |
| Instability index | 51.39 |
| Isoelectric point | 5.27 |
| Molecular weight | 27903.24 |
| Publications | PubMed=23127152
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33748
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 103.41| 29| 29| 39| 67| 1
---------------------------------------------------------------------------
17- 35 (20.39/ 9.51) ....DIEVL.......S..........RELVEMLALSRSQ
39- 67 (48.58/30.77) QPGEDTQVLELLV.QRD..........KEFQELMRTALRQ
69- 108 (34.43/20.10) RTHEEMQKLEKEVeKRDgdiqllqkqlKEAEHILATAVYQ
---------------------------------------------------------------------------
|