<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33746

Description Cyclin-dependent kinase 19
SequenceMDYDFKTKLAAERERVEDLFEYEGCKVGRGTYGHVYKAKRKDGKDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRGMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFLEDPLPTSDVFAGCQIPYPKREFLNEDEPEEKTEKNQTQQHQQTQAQTQTQAQQAPSQQSSAQTNGTSGGTTGPAMQHAGQEQGPPNKKSRTTGANVLQTDYQHSSSRLGYQSNVQGTTQSQSTMGYSSTSQQSSQYSHQSHRY
Length479
PositionKinase
OrganismIctalurus punctatus (Channel catfish) (Silurus punctatus)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Siluriformes> Ictaluridae> Ictalurus.
Aromaticity0.09
Grand average of hydropathy-0.734
Instability index47.64
Isoelectric point8.66
Molecular weight54897.48
Publications
PubMed=23127152

Function

Annotated function 
GO - Cellular Component
GO - Biological Function
ATP binding	GO:0005524	IEA:UniProtKB-UniRule
protein serine/threonine kinase activity	GO:0004674	IEA:UniProtKB-KW

GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP33746
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.27|      25|      40|     102|     129|       1
---------------------------------------------------------------------------
  102-  129 (44.55/42.81)	HDLWhiiKFHRASK.ANKKPM.QLP.RGMVK
  143-  170 (34.73/24.02)	HANW...VLHRDLKpANILVMgEGPeRGRVK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.81|      14|      15|     442|     456|       2
---------------------------------------------------------------------------
  442-  455 (25.45/19.06)	SRLGYQSNVQGTTQ
  458-  471 (25.37/13.03)	STMGYSSTSQQSSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.34|      15|      15|     377|     391|       3
---------------------------------------------------------------------------
  385-  400 (21.11/ 9.68)	TQAQQAPsQQSSAQTN
  403-  418 (22.23/10.55)	SGGTTGPaMQHAGQEQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP33746 with CDK8 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) IPYPKREFLNEDEPEEKTEKNQTQQHQQTQAQTQTQAQQAPSQQSSAQTNGTSGGTTGPAMQHAGQEQGPPNKKSRTTGANVLQTDYQHSSSRLGYQSNVQGTTQSQSTMGYSSTSQQSSQYSHQSHRY
351
479










Molecular Recognition Features






MoRF SequenceStartStop




NANANA