| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MTEIFSTLFGQSDAQAPPSSAALGFGPGKPPPPHPQSAAPVPPQLSGQLGDEGPTARKPGVINEPFYLLRELPVGNDLTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDSPGVQDGSSLRSLIEKPPVCGNSFSPLTGALLTGFRLHTGPLPEQYRLMHIQPPKKKSKHKHRHHRPQDPIPPETPSDSDPKKKKKKRDDDPERKKKKKDKKKKKNRHSPDHPGITGSQPNSNSLR |
| Length | 244 |
| Position | Head |
| Organism | Ictalurus punctatus (Channel catfish) (Silurus punctatus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Siluriformes> Ictaluridae> Ictalurus. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.041 |
| Instability index | 59.32 |
| Isoelectric point | 9.82 |
| Molecular weight | 26867.32 |
| Publications | PubMed=23127152 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP33745
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.37| 14| 23| 11| 24| 1
---------------------------------------------------------------------------
11- 24 (26.13/13.29) QSDAQAPPS.SAALG
36- 50 (23.24/11.09) QSAAPVPPQlSGQLG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 79.23| 18| 21| 191| 210| 2
---------------------------------------------------------------------------
171- 187 (32.19/10.19) P..PKKKSKHKHRHHRP..QD
191- 209 (27.35/10.90) PeTPSDSDPKKKKKKRD..DD
212- 230 (19.68/ 7.09) ..RKKKKKDKKKKKNRHspDH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.60| 10| 21| 111| 120| 3
---------------------------------------------------------------------------
111- 120 (20.15/10.78) PELPGMIDSP
135- 144 (21.45/11.94) PPVCGNSFSP
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DPKKKKKKRDDDPERKKKKKDKKKKKNRHSP 2) YRLMHIQ | 198 164 | 228 170 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab