Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MTEIFSTLFGQSDAQAPPSSAALGFGPGKPPPPHPQSAAPVPPQLSGQLGDEGPTARKPGVINEPFYLLRELPVGNDLTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDSPGVQDGSSLRSLIEKPPVCGNSFSPLTGALLTGFRLHTGPLPEQYRLMHIQPPKKKSKHKHRHHRPQDPIPPETPSDSDPKKKKKKRDDDPERKKKKKDKKKKKNRHSPDHPGITGSQPNSNSLR |
Length | 244 |
Position | Head |
Organism | Ictalurus punctatus (Channel catfish) (Silurus punctatus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Siluriformes> Ictaluridae> Ictalurus. |
Aromaticity | 0.05 |
Grand average of hydropathy | -1.041 |
Instability index | 59.32 |
Isoelectric point | 9.82 |
Molecular weight | 26867.32 |
Publications | PubMed=23127152 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33745 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 49.37| 14| 23| 11| 24| 1 --------------------------------------------------------------------------- 11- 24 (26.13/13.29) QSDAQAPPS.SAALG 36- 50 (23.24/11.09) QSAAPVPPQlSGQLG --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 79.23| 18| 21| 191| 210| 2 --------------------------------------------------------------------------- 171- 187 (32.19/10.19) P..PKKKSKHKHRHHRP..QD 191- 209 (27.35/10.90) PeTPSDSDPKKKKKKRD..DD 212- 230 (19.68/ 7.09) ..RKKKKKDKKKKKNRHspDH --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 41.60| 10| 21| 111| 120| 3 --------------------------------------------------------------------------- 111- 120 (20.15/10.78) PELPGMIDSP 135- 144 (21.45/11.94) PPVCGNSFSP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DPKKKKKKRDDDPERKKKKKDKKKKKNRHSP 2) YRLMHIQ | 198 164 | 228 170 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab