Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MQRLTLEHLNQMVGVEYILLHAQEPILFIIRKQQRQSPTQVIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAFDEAMSYCRYHPSKGYWWHFKDHEEQDKVKPKVKRKEEPSSIFQRQRVDALLLDLRQKFPPKFVQQKSGEKPVPVDQTKKEAEPLPETVKSEEKETTKNVQQTVGTKGPPEKRMRLQ |
Length | 195 |
Position | Head |
Organism | Ovis aries (Sheep) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Ruminantia> Pecora> Bovidae> Caprinae> Ovis. |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.715 |
Instability index | 49.07 |
Isoelectric point | 9.30 |
Molecular weight | 22644.80 |
Publications | PubMed=20809919 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 PIRNR:PIRNR023869 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro nucleoplasm GO:0005654 IEA:Ensembl |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP33742 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) KNVQQ 2) PPEKRMRLQ 3) QTKKEAEPLPETVKSEE 4) VDALLLDLRQKFPPKFVQ | 176 187 155 126 | 180 195 171 143 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab