<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33741
Description |
Mediator of RNA polymerase II transcription subunit 4 |
Sequence | SGKEKERPGGGLGVAGGNSTRERLLSALENLEVLSRELIEMLAISRNQKLLQSGEENHVLELLIHRDGEFQELMKLALNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDGFAPQYPWQASDMAMSMLPPNHSHDFLLEPPGHNKENEDDVEVMSTDSSSSSSDSD |
Length | 264 |
Position | Middle |
Organism | Ovis aries (Sheep) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Ruminantia> Pecora> Bovidae>
Caprinae> Ovis.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.657 |
Instability index | 48.28 |
Isoelectric point | 5.27 |
Molecular weight | 29104.35 |
Publications | PubMed=20809919
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364141
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP33741
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 115.69| 28| 28| 88| 115| 1
---------------------------------------------------------------------------
58- 85 (37.81/21.57) HVLELLI.HRDGEFQELMKlALNQGKIHH
88- 115 (42.88/25.27) QVLEKEVEKRDSDIQQLQK.QLKEAEQIL
118- 143 (34.99/19.52) AVYQAK.EKLKS.IEKARK.GAISSEEII
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 36.14| 12| 24| 19| 30| 2
---------------------------------------------------------------------------
19- 30 (19.74/12.94) STRERLL.SALEN
45- 57 (16.40/ 9.62) SRNQKLLqSGEEN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.64| 14| 18| 201| 214| 3
---------------------------------------------------------------------------
201- 214 (25.11/14.81) LAAGRLPDGFAPQY
221- 234 (27.52/16.86) MAMSMLPPNHSHDF
---------------------------------------------------------------------------
|