Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MAEKFDHLEEHLEKFVENIRQLGIIVSDLQPSSQAGLPPTLANFIVTGLQDIDKCRQQLHDITVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELSKVFPEDMAKYRSIRGEDHPPS |
Length | 136 |
Position | Middle |
Organism | Ovis aries (Sheep) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Ruminantia> Pecora> Bovidae> Caprinae> Ovis. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.523 |
Instability index | 45.69 |
Isoelectric point | 5.58 |
Molecular weight | 15649.78 |
Publications | PubMed=20809919 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl nucleoplasm GO:0005654 IEA:Ensembl |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:Ensembl stem cell population maintenance GO:0019827 IEA:Ensembl |
Binary Interactions |
Repeats | >MDP33737 No repeats found |
MoRF Sequence | Start | Stop |
1) ALAKN 2) MAKYRSIRGE | 89 122 | 93 131 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab