<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33724

Description Mediator complex subunit 30
SequenceTPCPPLPLWGRGGGPGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQSEKLPNGVTYHTGTYQDRLAKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN
Length178
PositionHead
OrganismOvis aries (Sheep)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Artiodactyla> Ruminantia> Pecora> Bovidae> Caprinae> Ovis.
Aromaticity0.06
Grand average of hydropathy-0.694
Instability index46.38
Isoelectric point8.69
Molecular weight20416.20
Publications
PubMed=20809919

Function

Annotated function 
GO - Cellular Component
mediator complex	GO:0016592	IEA:Ensembl

GO - Biological Function
thyroid hormone receptor binding	GO:0046966	IEA:Ensembl
transcription coactivator activity	GO:0003713	IEA:Ensembl

GO - Biological Process
positive regulation of transcription initiation from RNA polymerase II promoter	GO:0060261	IEA:Ensembl
stem cell population maintenance	GO:0019827	IEA:Ensembl









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP33724
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.58|      21|      68|      78|      98|       1
---------------------------------------------------------------------------
   78-   98 (35.66/26.52)	KLQDHLRQLSILFRKLR.LVYD
  148-  169 (32.91/23.97)	KLKQKNQQLKQIMDQLRnLIWD
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP33724 with Med30 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) LIPYVEEDGSKDDRAGPPRFASEERREIAEVNK
115
147










Molecular Recognition Features






MoRF SequenceStartStop




NANANA