<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33724
| Description |
Mediator complex subunit 30 |
| Sequence | TPCPPLPLWGRGGGPGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQSEKLPNGVTYHTGTYQDRLAKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPVEQLIPYVEEDGSKDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN |
| Length | 178 |
| Position | Head |
| Organism | Ovis aries (Sheep) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Ruminantia> Pecora> Bovidae>
Caprinae> Ovis.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.694 |
| Instability index | 46.38 |
| Isoelectric point | 8.69 |
| Molecular weight | 20416.20 |
| Publications | PubMed=20809919
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
| GO - Biological Function | thyroid hormone receptor binding GO:0046966 IEA:Ensembl
transcription coactivator activity GO:0003713 IEA:Ensembl
|
| GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IEA:Ensembl
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP33724
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.58| 21| 68| 78| 98| 1
---------------------------------------------------------------------------
78- 98 (35.66/26.52) KLQDHLRQLSILFRKLR.LVYD
148- 169 (32.91/23.97) KLKQKNQQLKQIMDQLRnLIWD
---------------------------------------------------------------------------
|