<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33710
Description |
Uncharacterized protein |
Sequence | MAASLGGMFSGQPPGPPQPPPGLLGQASLLQATPGVPRTSNSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPDQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINMQHKKPADIPQGSLAYLEQASANIPAPMKQT |
Length | 178 |
Position | Head |
Organism | Ovis aries (Sheep) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Artiodactyla> Ruminantia> Pecora> Bovidae>
Caprinae> Ovis.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.481 |
Instability index | 54.16 |
Isoelectric point | 5.38 |
Molecular weight | 19708.16 |
Publications | PubMed=20809919
|
Function
Annotated function |
|
GO - Cellular Component | nucleoplasm GO:0005654 IEA:Ensembl
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP33710
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.88| 21| 138| 12| 37| 2
---------------------------------------------------------------------------
12- 37 (31.14/27.16) QPPGPPQpppGLLgqASLLQATPGVP
152- 172 (38.75/18.25) KPADIPQ...GSL..AYLEQASANIP
---------------------------------------------------------------------------
|