<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33698
Description |
Cyclin C |
Sequence | MAGNFWQSSHYLQWILDKQDLMKERQKDLKFLTEEEYWKLQIFFANVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLISAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYDQWKNFDDRKEMAAVLNKMPKPKPPPNSESDQSSNGNQNSTYNQS |
Length | 283 |
Position | Kinase |
Organism | Lepisosteus oculatus (Spotted gar) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Holostei> Semionotiformes> Lepisosteidae>
Lepisosteus.
|
Aromaticity | 0.13 |
Grand average of hydropathy | -0.185 |
Instability index | 50.74 |
Isoelectric point | 6.95 |
Molecular weight | 33319.37 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nucleus GO:0005634 IBA:GO_Central
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IBA:GO_Central
|
GO - Biological Process | glomerular visceral epithelial cell development GO:0072015 IEA:Ensembl
positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP33698
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.31| 26| 30| 16| 45| 1
---------------------------------------------------------------------------
16- 45 (34.67/37.19) LDK.QDLMKERQKDLKflTEEEYWKLqiFFA
48- 74 (37.64/25.53) IQAlGEHLKLRQQVIA..TATVYFKR..FYA
---------------------------------------------------------------------------
|