<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33698

Description Cyclin C
SequenceMAGNFWQSSHYLQWILDKQDLMKERQKDLKFLTEEEYWKLQIFFANVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTCVFLASKVEEFGVVSNTRLISAATSVLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYDQWKNFDDRKEMAAVLNKMPKPKPPPNSESDQSSNGNQNSTYNQS
Length283
PositionKinase
OrganismLepisosteus oculatus (Spotted gar)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Holostei> Semionotiformes> Lepisosteidae> Lepisosteus.
Aromaticity0.13
Grand average of hydropathy-0.185
Instability index50.74
Isoelectric point6.95
Molecular weight33319.37
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central
nucleus	GO:0005634	IBA:GO_Central

GO - Biological Function
cyclin-dependent protein serine/threonine kinase regulator activity	GO:0016538	IBA:GO_Central

GO - Biological Process
glomerular visceral epithelial cell development	GO:0072015	IEA:Ensembl
positive regulation of transcription by RNA polymerase II	GO:0045944	IBA:GO_Central
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP33698
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      72.31|      26|      30|      16|      45|       1
---------------------------------------------------------------------------
   16-   45 (34.67/37.19)	LDK.QDLMKERQKDLKflTEEEYWKLqiFFA
   48-   74 (37.64/25.53)	IQAlGEHLKLRQQVIA..TATVYFKR..FYA
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP33698 with CycC domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) AVLNKMPKPKPPPNSESDQSSNGNQNSTYNQS
252
283










Molecular Recognition Features






MoRF SequenceStartStop




NANANA