<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33693
| Description |
Uncharacterized protein |
| Sequence | NMASQQQQPQMSQAGGPQVQSGLQAPTQDFDPVHRFKMLIPQLKESLQNVMKIASLNLGHNTAIDNGVKSSDASVQRFDKSLEEFYALCDQLELCLRLAYECLSQSIDSAKHSPNLVPTATKPDTVQTESLSYSQYLSMIKSQISCAKDIHNALLECSKKIAGKGPSQGLL |
| Length | 171 |
| Position | Tail |
| Organism | Lepisosteus oculatus (Spotted gar) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Holostei> Semionotiformes> Lepisosteidae>
Lepisosteus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.385 |
| Instability index | 64.94 |
| Isoelectric point | 6.46 |
| Molecular weight | 18711.07 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | eye photoreceptor cell development GO:0042462 IEA:Ensembl
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP33693
No repeats found
No repeats found
|