<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33693
Description |
Uncharacterized protein |
Sequence | NMASQQQQPQMSQAGGPQVQSGLQAPTQDFDPVHRFKMLIPQLKESLQNVMKIASLNLGHNTAIDNGVKSSDASVQRFDKSLEEFYALCDQLELCLRLAYECLSQSIDSAKHSPNLVPTATKPDTVQTESLSYSQYLSMIKSQISCAKDIHNALLECSKKIAGKGPSQGLL |
Length | 171 |
Position | Tail |
Organism | Lepisosteus oculatus (Spotted gar) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Holostei> Semionotiformes> Lepisosteidae>
Lepisosteus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.385 |
Instability index | 64.94 |
Isoelectric point | 6.46 |
Molecular weight | 18711.07 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
transcription factor binding GO:0008134 IBA:GO_Central
|
GO - Biological Process | eye photoreceptor cell development GO:0042462 IEA:Ensembl
regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP33693
No repeats found
No repeats found
|