Description | Mediator of RNA polymerase II transcription subunit 10 |
Sequence | MAEKFDNLEEHLEKFVENIRQLGIIVSDFQPSSQTGLNQKLNFMITGLQDIDKCRQQLHDINVPLEVFEYIDQGRNPQLYTKECLERALAKNEQVKGKIDTMKKFKSLLIQELGKVFPEEMAKYKAIHGEDPPS |
Length | 134 |
Position | Middle |
Organism | Lepisosteus oculatus (Spotted gar) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Actinopterygii> Neopterygii> Holostei> Semionotiformes> Lepisosteidae> Lepisosteus. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.602 |
Instability index | 39.13 |
Isoelectric point | 5.42 |
Molecular weight | 15523.64 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364146 |
GO - Cellular Component | chromatin GO:0000785 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central |
GO - Biological Process | atrioventricular canal development GO:0036302 IEA:Ensembl cardiac jelly development GO:1905072 IEA:Ensembl positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
Binary Interactions |
Repeats | >MDP33684 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) AKYKAIH 2) LERALAKN | 122 85 | 128 92 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab