<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33672
Description |
Zgc:114119 |
Sequence | AMTALPSAGTRMPGLSPQHPQPGQLTQGTPAQLQSALPPQAAMREISPVFLCRIGQETVQDIVMRTMEIFQITRATQLPNGVTQSHAVYQERFNKLQEHLRQLALLFRKLRLLYERCMEMTSDLHETPSELIPYTSAEVSIVPVEPCSIAVTQERQEISEKVKQKNQEMKVLMDQMRNLLWDINAMLTLRK |
Length | 191 |
Position | Head |
Organism | Lepisosteus oculatus (Spotted gar) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Holostei> Semionotiformes> Lepisosteidae>
Lepisosteus.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.330 |
Instability index | 52.03 |
Isoelectric point | 7.96 |
Molecular weight | 21752.08 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription, DNA-templated GO:0045893 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP33672
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.42| 17| 61| 85| 102| 1
---------------------------------------------------------------------------
85- 102 (26.39/25.56) SHAVYQERfNKLQEHLRQ
148- 164 (28.03/20.66) SIAVTQER.QEISEKVKQ
---------------------------------------------------------------------------
|