<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33665
Description |
Uncharacterized protein |
Sequence | MASSMSGMFPGQQPPGPHPTGAPGGPGQPGLLPAATGARGQSTTLVDDLEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLQLSVQKPEQVVKEDVSELRNELQRKEALIQKHLSKIRHWQQVLEDINVQHKKPTELPQGPLAYLEQASANIPAPMKQN |
Length | 179 |
Position | Head |
Organism | Lepisosteus oculatus (Spotted gar) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Holostei> Semionotiformes> Lepisosteidae>
Lepisosteus.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.559 |
Instability index | 57.65 |
Isoelectric point | 5.57 |
Molecular weight | 19685.05 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP33665
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.66| 15| 15| 106| 120| 1
---------------------------------------------------------------------------
106- 120 (23.90/20.40) QKPEQVVKEDVSELR
124- 138 (23.76/20.23) QRKEALIQKHLSKIR
---------------------------------------------------------------------------
|