<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33664
| Description |
Mediator complex subunit 30 |
| Sequence | MATPPVAGAGMPAGAFGGQQAQAAREVNTASLCRIGQETVQDIVFRTMEIFQLLRNMQLPNGVTYHASTHQDRLGKLQEHLRQLSVLFRKLRLVYDKCNENCAGLDPVPAEQLIPYVEDDGSKHDDRSTNLARYATEERREVLEVNQKLKQKNQQLKQIMDQLRNLIWEINSMLAVRN |
| Length | 178 |
| Position | Head |
| Organism | Lepisosteus oculatus (Spotted gar) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Holostei> Semionotiformes> Lepisosteidae>
Lepisosteus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.535 |
| Instability index | 45.00 |
| Isoelectric point | 7.75 |
| Molecular weight | 20213.84 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription, DNA-templated GO:0045893 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP33664
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.94| 20| 52| 58| 77| 1
---------------------------------------------------------------------------
58- 77 (36.65/24.66) QLPNGVTYHASTHQDRLGKL
112- 131 (36.29/24.36) QLIPYVEDDGSKHDDRSTNL
---------------------------------------------------------------------------
|