<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33663
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MEAPPVTVMPVTGGTINMMEYLLQGSVLDHSLDSLLHRLRGLCDNMEPESFADHEMVYLLKGQQGNPFLLRARRSLDRPASPWHLRYLGQPEVGDKSRHALVRNCVDVAASQSLPDFLNEMGFRMDHEFVAKGHMFRKGALKVVVCKLFRMLVPGNTESIEALSLSYLVELSVLAPAGQDTVSEDMRSFAEQLKPLVHLEKIDPKRHM |
Length | 208 |
Position | Head |
Organism | Lepisosteus oculatus (Spotted gar) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Holostei> Semionotiformes> Lepisosteidae>
Lepisosteus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.171 |
Instability index | 46.82 |
Isoelectric point | 6.30 |
Molecular weight | 23407.92 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
termination of RNA polymerase II transcription GO:0006369 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP33663
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.52| 16| 23| 26| 41| 1
---------------------------------------------------------------------------
26- 41 (27.37/15.92) SVLDHSLDSLLHRLRG
50- 65 (29.15/17.32) SFADHEMVYLLKGQQG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.47| 20| 27| 73| 94| 4
---------------------------------------------------------------------------
73- 94 (33.27/27.98) RRSLDRPASPWHLRYLGqpEVG
103- 122 (36.20/22.87) RNCVDVAASQSLPDFLN..EMG
---------------------------------------------------------------------------
|