<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33642
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MTEMFSSLYGQTDTQGPPGPSALGFGPGKPLAPPAAQNQVHMSVGIPHQLVDEGPPLRKPGAMNEPFYLLRELPVENELTGNTNLITHYNLEHAYNKFCGKKVKEKLSNFLPELPGMIDNPGLQDGSSLRSLIEKPPVCNNSFSPLTGAMLTGFRLHTGPLPEQYRLMHIQPPKKKSKHKHRHHRPQDPLPPETPSDSDHKKKKKKKDDDPDRKKKKKDKKKKKNRHSPDHPGMTGSQPSGSSLR |
| Length | 245 |
| Position | Head |
| Organism | Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Characiformes>
Characoidei> Characidae> Astyanax.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.080 |
| Instability index | 49.77 |
| Isoelectric point | 9.73 |
| Molecular weight | 27307.96 |
| Publications | PubMed=25329095
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33642
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.99| 13| 18| 199| 211| 1
---------------------------------------------------------------------------
199- 211 (24.85/11.35) DHKKKKKKK.DDDP
219- 232 (21.14/ 8.64) DKKKKKNRHsPDHP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.77| 12| 114| 116| 130| 2
---------------------------------------------------------------------------
116- 130 (19.98/15.97) GMidnPGLQ.DGSSLR
233- 245 (19.80/ 8.37) GM...TGSQpSGSSLR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.41| 12| 37| 15| 27| 3
---------------------------------------------------------------------------
15- 27 (21.30/13.89) QGPP..GPSALGfGP
53- 66 (21.11/ 8.60) EGPPlrKPGAMN.EP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 37.11| 10| 26| 155| 164| 4
---------------------------------------------------------------------------
155- 164 (20.08/ 9.52) RLH..TGPLPEQ
182- 193 (17.03/ 7.01) RHHrpQDPLPPE
---------------------------------------------------------------------------
|