<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33641
| Description |
Uncharacterized protein |
| Sequence | SVPGSAPKIGANQVSDVVFVIEGTANLGPYFESLRKNYILPAIEYFNGGPPAETDFGGDYGGTQYGLVVFNTVDCAPESYVQCHAPTSSAYEFVSWIDKIQFMGGGAESCSLIAEGLSVALQLFDDFKKMREQIGQTHKVCVLLCNSPPYLLPAVESVSYTGCTTDNLVQIIRDGIHFSVVAPRKLPALRALFERASPVGAPSESSHPDYSQDPFHMVLIRGITSLLISCFFFLHCLPDFFARFLVPGMVNAGPPFSTQPVKLTSVSQPSLSTVTTVSTPMLQQQQAPPQQQPQPSQVPPPGQPTPNQQAPQPPQQQQAPNQQPPPSSQPGPGQMLMAGGPRGSVAQNPGMPQVSSVMEDEILMDLI |
| Length | 367 |
| Position | Unknown |
| Organism | Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Characiformes>
Characoidei> Characidae> Astyanax.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.118 |
| Instability index | 58.00 |
| Isoelectric point | 4.90 |
| Molecular weight | 39416.39 |
| Publications | PubMed=25329095
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33641
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 86.87| 21| 23| 284| 306| 1
---------------------------------------------------------------------------
284- 304 (45.19/14.44) QQQAPPQQQPQPSQVPPPGQP
321- 341 (41.68/10.68) NQQPPPSSQPGPGQMLMAGGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.52| 16| 202| 38| 55| 3
---------------------------------------------------------------------------
38- 55 (26.19/17.65) YILPAIeyFNGGPPAETD
244- 259 (31.33/14.99) FLVPGM..VNAGPPFSTQ
---------------------------------------------------------------------------
|