<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33637
| Description |
Uncharacterized protein |
| Sequence | MSQQQQVAATGAVVGVGVSAAAAAVLQPQQQQQLSQQQDFDPVHRFKLLIPQLKESLQNVMSIASQNFAYNTSIDNGVKSNDATVQRFDKSLEEFYALCDQLELCLRLAHECLSQSIDSAKHSPNLVPTATKPDTVQTESLSYSQYLSMIKSQISCAKDIHNALLECSKKIAGKGQQQGIL |
| Length | 181 |
| Position | Tail |
| Organism | Astyanax mexicanus (Blind cave fish) (Astyanax fasciatus mexicanus) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi>
Actinopterygii> Neopterygii> Teleostei> Ostariophysi> Characiformes>
Characoidei> Characidae> Astyanax.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.265 |
| Instability index | 59.94 |
| Isoelectric point | 6.05 |
| Molecular weight | 19753.13 |
| Publications | PubMed=25329095
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | eye photoreceptor cell development GO:0042462 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP33637
No repeats found
No repeats found
|