<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33631
| Description |
Uncharacterized protein |
| Sequence | MACFDSRRTPPACCADLCGIRWRQLVYGERPNASSDPLDDPVLRSYSKCLAVDILCVWRRVAAPKPKPKLDPDPSSMFDMSIPGTGNSGSVLHPPLSLTAAKELWIFWYGEEPDLTELVAPELLNSSGKSKDIRRSLAEGTPKFPWCKVNRKLETGDDDGRPPCLSID |
| Length | 168 |
| Position | Middle |
| Organism | Anopheles darlingi (Mosquito) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.407 |
| Instability index | 57.59 |
| Isoelectric point | 5.90 |
| Molecular weight | 18589.11 |
| Publications | PubMed=20920257
PubMed=23761445
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33631
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.55| 15| 33| 22| 37| 1
---------------------------------------------------------------------------
22- 37 (24.27/17.46) WRQLVyGERPNASSDP
58- 72 (29.29/15.96) WRRVA.APKPKPKLDP
---------------------------------------------------------------------------
|