| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MFNNYGNAITPDQFRKVEQYSPKSSPRAGGAGGRSPVVSRQDSSGTLKTTIQLGKNPSILHSGPFYLMKEPPGEGELTGATNLMAHYGLEHSYSKFSGKKVKEQLSSFLPNLPGVIDGPGHLDNSSLRSVIEKPPIVGKELLPLTSVQLAGFRLHPGPLPEQYKLLKTTPTRKHKNKHKKHKHKDGVAPPEQSALEAAGLDTHEKKHKKQKRHEDDKERKKRKKEKKRKKQRHSPEHPGGGAASVPPQTQVY |
| Length | 252 |
| Position | Head |
| Organism | Anopheles darlingi (Mosquito) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota> Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae> Anophelinae> Anopheles. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.059 |
| Instability index | 55.04 |
| Isoelectric point | 10.02 |
| Molecular weight | 27879.44 |
| Publications | PubMed=20920257 PubMed=23761445 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP33611
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 96.45| 25| 27| 160| 185| 1
---------------------------------------------------------------------------
160- 182 (30.15/18.93) .......PEQyKLL.KTTPTRKHKNKHKKHK
183- 211 (38.72/20.01) HKDgvapPEQ.SAL.EAAGLDTHEKKHKKQK
213- 232 (27.59/12.36) HED...........dKERKKRKKEKKRKKQR
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) THEKKHKKQKRHEDDKERKKRKKEKKRKKQRHSPEHP 2) YKLLKT | 202 163 | 238 168 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab