<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33607
Description |
Srb7p: RNA polymerase II holoenzyme component |
Sequence | MADRLTQLQDTVNQQAEHFCNSIGILQQCSVPSKFAGFERTGSQTPQQQVQTQEDYPQLFSTLISRCAKDIDTLIESLPSEESSIELQVQSLQRLEQENKESAEKLEEIVRKGELLLEKIQAALSDIAQSQLDMQYSS |
Length | 138 |
Position | Middle |
Organism | Anopheles darlingi (Mosquito) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.574 |
Instability index | 63.38 |
Isoelectric point | 4.42 |
Molecular weight | 15578.17 |
Publications | PubMed=20920257
PubMed=23761445
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU366036
|
GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP33607
No repeats found
No repeats found
|