<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33603
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MCVCERAAPDVKILAFKRRRVKSKKEGKTGAEITFSWGFRQQSYYKSDPCCPCRKIPRAGASGVHRKLGRNNGSHERRRMVMMNPYGLAVESEDAQKLRFQVELEFVQCLANPNYLHFLAQRGYFKDAAFVNYLKYLLYWKEPEYAKYIKFPMCLYFLDLLQYEHFRREIVSAQCCKFIDDQAILLWQHYTRRRTRLTALGTTSLTGLAVGGQPVGGGVQGTLLSNEPSIMASCNNGNNGSQNSSSNNGTMSGSGGLMNSNSMNSNNGPNGAGGGVNLPPSSTQQSIAQNGGASMTQHNGVGGLLMGNPLGSLGSGAAGGAGSVTGGGSINQKVP |
| Length | 335 |
| Position | Middle |
| Organism | Anopheles darlingi (Mosquito) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.417 |
| Instability index | 37.30 |
| Isoelectric point | 9.57 |
| Molecular weight | 36260.80 |
| Publications | PubMed=20920257
PubMed=23761445
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33603
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 73.12| 14| 16| 246| 259| 1
---------------------------------------------------------------------------
225- 238 (21.21/ 9.50) SNEPSIMASCNNGN
246- 259 (27.29/14.61) SNNGTMSGSGGLMN
265- 277 (24.62/12.36) SNNGP.NGAGGGVN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.79| 20| 23| 147| 168| 2
---------------------------------------------------------------------------
149- 168 (38.97/38.18) IKFPMCLYFLD...LLQYEHFRR
170- 192 (33.82/23.18) IVSAQCCKFIDdqaILLWQHYTR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.03| 18| 107| 200| 218| 3
---------------------------------------------------------------------------
200- 218 (29.81/16.02) LGTTSlTGLAVG.GQPVGGG
310- 328 (29.22/11.99) LGSLG.SGAAGGaGSVTGGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 26.95| 8| 16| 106| 119| 4
---------------------------------------------------------------------------
106- 119 (10.90/18.59) FVqclanpNYLHFL
130- 137 (16.06/ 7.15) FV......NYLKYL
---------------------------------------------------------------------------
|