<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33601
| Description |
Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MANAEAIQVSSLPLPPAQYINLYTDDNIRKNRAPKPPAPIQDAYTMFGSPFNNDDNIIRPLEIQGFKRLYPQHFDRRKELKKLNHSLLVNFLDLIDLLVHYPDSPRRAEKIDDLNLLFVHIHHLLNEFRPHQARETLRVMMELQKRQRIETAQRFQNHLEKVREMVKNAFASLPDLTDADRMGGGLEPMDVGEAGDLAGGRGEGCHPLDRLMCEIVDRM |
| Length | 219 |
| Position | Middle |
| Organism | Anopheles darlingi (Mosquito) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.557 |
| Instability index | 46.88 |
| Isoelectric point | 6.31 |
| Molecular weight | 25253.68 |
| Publications | PubMed=20920257
PubMed=23761445
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33601
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.54| 20| 26| 26| 51| 1
---------------------------------------------------------------------------
26- 51 (32.25/31.30) DNIRKnrapkpPAPIQDAYTMFGSPF
55- 74 (36.29/20.33) DNIIR......PLEIQGFKRLYPQHF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.52| 18| 26| 87| 106| 2
---------------------------------------------------------------------------
87- 106 (27.83/17.87) LLvnFLDLIDLLVHY.PDSPR
116- 134 (29.69/13.84) LL..FVHIHHLLNEFrPHQAR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.79| 11| 18| 180| 190| 3
---------------------------------------------------------------------------
180- 190 (23.33/14.39) DRMGG...GLEPMD
196- 209 (18.46/10.10) DLAGGrgeGCHPLD
---------------------------------------------------------------------------
|