<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33600
Description |
Cdk8 |
Sequence | MTTAVMMDYEFKMKTQQERAKVEDLFEYEGCKVGRGTYGHVYKAHRKEGNDPKDYALKQIEGTGLSMSACREIALLRELKHPNVINLIRVFLSHTDRKVWLLFDYAEHDLWHIIKFHRAAKATKKPVMVPKGMVKSLLYQILDGIHYLHSNWVLHRDLKPANILVMGEGNERGRVKIADMGFARLFNAPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPQDKDWEDIRKMPEHHTLTKDFKRSNYASCSLIKYMERHKIKPDSKAFHLLQKLLLMDPNKRITSEQAMQDPYFSEDPMPTADVFAGCPIPYPKREFLTDEDQDDKGEKRQQQQQQQQQQHNSSSSNKTISNKISKEIMRSNNSPEILSKCSRVVVKVGAVWIIMEPNGYG |
Length | 438 |
Position | Kinase |
Organism | Anopheles darlingi (Mosquito) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.560 |
Instability index | 45.95 |
Isoelectric point | 8.81 |
Molecular weight | 50829.99 |
Publications | PubMed=20920257
PubMed=23761445
|
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein serine/threonine kinase activity GO:0004674 IEA:UniProtKB-KW
|
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP33600
No repeats found
|