<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33600
| Description |
Cdk8 |
| Sequence | MTTAVMMDYEFKMKTQQERAKVEDLFEYEGCKVGRGTYGHVYKAHRKEGNDPKDYALKQIEGTGLSMSACREIALLRELKHPNVINLIRVFLSHTDRKVWLLFDYAEHDLWHIIKFHRAAKATKKPVMVPKGMVKSLLYQILDGIHYLHSNWVLHRDLKPANILVMGEGNERGRVKIADMGFARLFNAPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPYHHDQLDRIFNVMGFPQDKDWEDIRKMPEHHTLTKDFKRSNYASCSLIKYMERHKIKPDSKAFHLLQKLLLMDPNKRITSEQAMQDPYFSEDPMPTADVFAGCPIPYPKREFLTDEDQDDKGEKRQQQQQQQQQQHNSSSSNKTISNKISKEIMRSNNSPEILSKCSRVVVKVGAVWIIMEPNGYG |
| Length | 438 |
| Position | Kinase |
| Organism | Anopheles darlingi (Mosquito) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Arthropoda> Hexapoda> Insecta> Pterygota>
Neoptera> Endopterygota> Diptera> Nematocera> Culicoidea> Culicidae>
Anophelinae> Anopheles.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.560 |
| Instability index | 45.95 |
| Isoelectric point | 8.81 |
| Molecular weight | 50829.99 |
| Publications | PubMed=20920257
PubMed=23761445
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:UniProtKB-UniRule
protein serine/threonine kinase activity GO:0004674 IEA:UniProtKB-KW
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33600
No repeats found
|