<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33590
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MPTPIRQRSPMPTKQFLSPPSVDPEPFYLLKDPPISGPGSEVTGETHMISHYGLEHSYNKFSTKKLKEQLSAFLPLLPGNIDTVSSQDNSSLQSVIEKPPITKEITTFTTGMLQGFKLHPGSIPDQYKLLHHQPAKKHKHKKHKRDHRIPELSEPMSAGAEAGGDNGHEKKHKKTKKHGDQDGEKKKRDKKKKKKKARQDPMHPGMPATHEGSGPGRP |
| Length | 218 |
| Position | Head |
| Organism | Strongylocentrotus purpuratus (Purple sea urchin) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -1.175 |
| Instability index | 61.67 |
| Isoelectric point | 9.80 |
| Molecular weight | 24352.57 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33590
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.77| 12| 31| 136| 147| 1
---------------------------------------------------------------------------
136- 147 (23.54/10.09) KKHKHKKHKRDH
170- 181 (22.23/ 9.18) KKHKKTKKHGDQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 38.55| 11| 41| 70| 81| 3
---------------------------------------------------------------------------
70- 81 (16.70/13.85) LSAFlPLLPGNI
113- 123 (21.85/13.15) LQGF.KLHPGSI
---------------------------------------------------------------------------
|