<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33584
Description |
Uncharacterized protein |
Sequence | MQVRAGNIVRAGESLISLVADIKQFLILNDFPLANENIEKRARFLGNVQNNVDSKIVQLRDELSNDLYEIEEEYYSSRYK |
Length | 80 |
Position | Head |
Organism | Strongylocentrotus purpuratus (Purple sea urchin) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.409 |
Instability index | 51.92 |
Isoelectric point | 4.85 |
Molecular weight | 9278.35 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP33584
No repeats found
No repeats found
|