<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33575
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MAMPTLAGNSQHPNQGMEPPQDPEQIRFEVELEFVQCLANPHYLNFLAQRGYFKDKKFVNYLHYLQYWKEPNYAKYLKFPQCLHFLELLQYEHFRRELANAQCVKFIEDQQLLHWQHYTRRRMRLQQSHLETTQQQQQLAQQQQQQGVAGATGGVAASGVANQPAGPGIMQAPLPPQQHPHQQQQQHPSLQQQQQQQMASQMRTGQQDQKPLQQGSATQQTMK |
| Length | 223 |
| Position | Middle |
| Organism | Strongylocentrotus purpuratus (Purple sea urchin) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.984 |
| Instability index | 67.29 |
| Isoelectric point | 8.75 |
| Molecular weight | 25997.97 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33575
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 96.48| 27| 49| 127| 153| 1
---------------------------------------------------------------------------
127- 149 (37.48/10.70) .....................QSHL....ETTQQQQQ...LAQQQQQQGVA
150- 199 (30.86/ 7.57) GATGgvaasgvanqpagpgimQAPLppqqHPHQQQQQhpsL.QQQQQQQMA
202- 220 (28.14/ 6.28) MRTG.................QQDQ....KPLQQGS.....ATQQ......
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 86.31| 20| 22| 77| 98| 2
---------------------------------------------------------------------------
57- 75 (28.68/11.35) KFVNYLHYLQ...YWKEPNY.AK.
78- 97 (39.58/21.06) KFPQCLHFLE...LLQYEHF.RRE
101- 122 (18.05/ 7.94) ..AQCVKFIEdqqLLHWQHYtRRR
---------------------------------------------------------------------------
|