<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33571
Description |
Uncharacterized protein |
Sequence | MSGVGQSLGGSSTKEVNAASLCRLGQETVQDLVTETQDMFSNLKGVQLPNGRSNTQQSHQDKITKLQDITKHIEVHFKKLRLLYDKCIQISSGVHTASGTHTPSEDLIMWKDVISSKDLIALGSREKAQYLNDKRLHLMEQLQAKNRQLRQVMEQMRHLMWDINTMLATRHSTPDWK |
Length | 177 |
Position | Head |
Organism | Strongylocentrotus purpuratus (Purple sea urchin) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.627 |
Instability index | 45.50 |
Isoelectric point | 9.12 |
Molecular weight | 20138.79 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP33571
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.93| 14| 28| 26| 39| 1
---------------------------------------------------------------------------
26- 39 (24.24/14.45) QETVQDLVTETQDM
56- 69 (24.69/14.82) QQSHQDKITKLQDI
---------------------------------------------------------------------------
|