<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33565
| Description |
Uncharacterized protein |
| Sequence | MAVTVGMEQQLHEMLADVLRTTAIEEAFAGFVCTQDSEKNKIIVCYENFMRFWTTIPAESQDRMLKQYVNHIHTLTSHQRVRILCDILANAVEKGLIPAKLVCEALLTSKDLDYKSSYMWCQSFHIIQKIINSADYKVRADDKAGLIS |
| Length | 148 |
| Position | Tail |
| Organism | Strongylocentrotus purpuratus (Purple sea urchin) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.040 |
| Instability index | 40.12 |
| Isoelectric point | 6.19 |
| Molecular weight | 16916.44 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33565
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.89| 13| 18| 26| 38| 1
---------------------------------------------------------------------------
26- 38 (23.94/15.52) EAFAGFVCTQDSE
47- 59 (25.95/17.27) ENFMRFWTTIPAE
---------------------------------------------------------------------------
|