<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33562
Description |
Mediator of RNA polymerase II transcription subunit 15 |
Sequence | MGKTNMFQPLLDAVKANIDSPYINHTLQRTFGPALTTLQGNPSHFPSPPAKKLKTEHDRSPTTQTAIPNIIQGEVARLAPKFRVNLDPMFHTSSKDVHLICRLDDKHLPSVPPINVAIPEQYPELSPNYDVSQQEYGQTPFLKLVQAALQNQVMRMPDRYTLTQILDAWEMSVRKSCLKMIAARDAT |
Length | 187 |
Position | Tail |
Organism | Strongylocentrotus purpuratus (Purple sea urchin) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.437 |
Instability index | 54.35 |
Isoelectric point | 8.89 |
Molecular weight | 21058.01 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP33562
No repeats found
No repeats found
|