<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33558
| Description |
Uncharacterized protein |
| Sequence | MATHVGPSTDRHLVDELEAAFKACLSPLVAQENVHVSDQVELKTSVDQSMQRYQELAKETENFFLQRQMLMATTKPESIIKEEIDELKAELTRKNALLQKQQTKVNNWLGILQSLECGGPPQQQPHAQQQQLHHGQIQQQQQQLARGTMSIPSGNIPQQQSGGQQHHGVVGAASIAGGGDATPISIATTPLSGPLAHLEQATSNIGGFDRR |
| Length | 211 |
| Position | Head |
| Organism | Strongylocentrotus purpuratus (Purple sea urchin) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.584 |
| Instability index | 60.61 |
| Isoelectric point | 5.96 |
| Molecular weight | 23033.56 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33558
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 79.74| 25| 28| 152| 178| 1
---------------------------------------------------------------------------
152- 178 (40.39/24.08) PSGnIPQQQSGGQQHHgVVGAASIAGG
183- 207 (39.35/16.12) PIS.IATTPLSGPLAH.LEQATSNIGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 86.49| 19| 67| 1| 19| 2
---------------------------------------------------------------------------
1- 19 (33.24/27.74) MATHVGPSTDR..HLVDELEA
42- 62 (24.00/17.97) LKTSVDQSMQRyqELAKETEN
71- 89 (29.25/23.52) MATTKPESIIK..EEIDELKA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.18| 12| 16| 113| 124| 3
---------------------------------------------------------------------------
113- 124 (24.57/10.31) QSLECGGPPQQQ
130- 141 (23.62/ 9.69) QQLHHGQIQQQQ
---------------------------------------------------------------------------
|