<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33558

Description Uncharacterized protein
SequenceMATHVGPSTDRHLVDELEAAFKACLSPLVAQENVHVSDQVELKTSVDQSMQRYQELAKETENFFLQRQMLMATTKPESIIKEEIDELKAELTRKNALLQKQQTKVNNWLGILQSLECGGPPQQQPHAQQQQLHHGQIQQQQQQLARGTMSIPSGNIPQQQSGGQQHHGVVGAASIAGGGDATPISIATTPLSGPLAHLEQATSNIGGFDRR
Length211
PositionHead
OrganismStrongylocentrotus purpuratus (Purple sea urchin)
KingdomMetazoa
Lineage
Aromaticity0.03
Grand average of hydropathy-0.584
Instability index60.61
Isoelectric point5.96
Molecular weight23033.56
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP33558
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      79.74|      25|      28|     152|     178|       1
---------------------------------------------------------------------------
  152-  178 (40.39/24.08)	PSGnIPQQQSGGQQHHgVVGAASIAGG
  183-  207 (39.35/16.12)	PIS.IATTPLSGPLAH.LEQATSNIGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      86.49|      19|      67|       1|      19|       2
---------------------------------------------------------------------------
    1-   19 (33.24/27.74)	MATHVGPSTDR..HLVDELEA
   42-   62 (24.00/17.97)	LKTSVDQSMQRyqELAKETEN
   71-   89 (29.25/23.52)	MATTKPESIIK..EEIDELKA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.18|      12|      16|     113|     124|       3
---------------------------------------------------------------------------
  113-  124 (24.57/10.31)	QSLECGGPPQQQ
  130-  141 (23.62/ 9.69)	QQLHHGQIQQQQ
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP33558 with Med28 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) LECGGPPQQQPHAQQQQLHHGQIQQQQQQLARGTMSIPSGNIPQQQSGGQQHHGVVGAASIAGGGDATPISIATTPLSGPLAHLEQATSNIGGFDRR
115
211










Molecular Recognition Features






MoRF SequenceStartStop




NANANA