<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33553
Description |
Uncharacterized protein |
Sequence | CLQPLIQWVADYTIVSLAAVPPPGSPTNRPGVSLMRDVPTLVMLRELLLIIRMWGRLQKNCLPVFTTTADDPDVLIPSLFRLVSQIWVHYHDKQPTELDESLIDECTLLPSQVGVPPWDLSPVTEGKLDTQETQWLSGRAVVSCSCISLMPPVTQQSSTVRVVWEKRWERNCLCGGLWRTVTVHPA |
Length | 186 |
Position | Tail |
Organism | Strongylocentrotus purpuratus (Purple sea urchin) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.06 |
Grand average of hydropathy | 0.055 |
Instability index | 62.66 |
Isoelectric point | 5.57 |
Molecular weight | 20894.09 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP33553
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.41| 17| 126| 7| 23| 1
---------------------------------------------------------------------------
7- 23 (32.17/21.40) QWVADYTIVSLAAVP..PP
134- 152 (29.24/18.78) QWLSGRAVVSCSCISlmPP
---------------------------------------------------------------------------
|