<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33553
| Description |
Uncharacterized protein |
| Sequence | CLQPLIQWVADYTIVSLAAVPPPGSPTNRPGVSLMRDVPTLVMLRELLLIIRMWGRLQKNCLPVFTTTADDPDVLIPSLFRLVSQIWVHYHDKQPTELDESLIDECTLLPSQVGVPPWDLSPVTEGKLDTQETQWLSGRAVVSCSCISLMPPVTQQSSTVRVVWEKRWERNCLCGGLWRTVTVHPA |
| Length | 186 |
| Position | Tail |
| Organism | Strongylocentrotus purpuratus (Purple sea urchin) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.06 |
| Grand average of hydropathy | 0.055 |
| Instability index | 62.66 |
| Isoelectric point | 5.57 |
| Molecular weight | 20894.09 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33553
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.41| 17| 126| 7| 23| 1
---------------------------------------------------------------------------
7- 23 (32.17/21.40) QWVADYTIVSLAAVP..PP
134- 152 (29.24/18.78) QWLSGRAVVSCSCISlmPP
---------------------------------------------------------------------------
|