<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33536
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MDLNDLHPPDDYSHRFFIWHEWIQANGPLTSDNVFEYFAASMFYDKQSNNQVLRMQTMHTGMPIVNEAEELKRFTGIEFALVHAQPPSLFIIHKRERTSPEETRPLAAYFIMNNRIYQSPDMYSVLQNRLLTSLYSLQSSLDILRKHRPDYTPRTGFVWPIMEPPTSEDGNKKSATDDASASAEPDLAPGLTASLEKEKEMLSSGTSKKLQNNLLLLNAMRTTAAHTRQTFALQTQQVAAQNPAPEIVPVATAARQSMTPAPPGIRAATPLAAATTSGSHEAVPAKVPPGAGKKKKKRKSITT |
Length | 303 |
Position | Head |
Organism | Heterobasidion irregulare TC 32-1 |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Russulales> Bondarzewiaceae> Heterobasidion>
Heterobasidion annosum species complex.
|
Aromaticity | 0.07 |
Grand average of hydropathy | -0.511 |
Instability index | 51.93 |
Isoelectric point | 8.94 |
Molecular weight | 33685.87 |
Publications | PubMed=22463738
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP33536
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 194.40| 67| 82| 127| 208| 1
---------------------------------------------------------------------------
43- 131 (101.21/69.59) FYDKQSNNQVLRMQ....TMHTGM..PIVNeaeelkrftgiefalvhaqPPSLFIIHKRERT.......SPEETRPLAAYFIMNNRIYqSPDMYSvlQNRLL
134- 215 (93.19/89.69) LYSLQSSLDILRKHrpdyTPRTGFvwPIME...................PPTSEDGNKKSATddasasaEPDLAPGLTASLEKEKEML.SSGTSKklQNNLL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.44| 19| 24| 243| 264| 2
---------------------------------------------------------------------------
243- 264 (30.47/24.87) PapeIVPVATAARQSMTPA..PPG
270- 290 (29.96/15.98) P...LAAATTSGSHEAVPAkvPPG
---------------------------------------------------------------------------
|