<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33525
| Description |
Uncharacterized protein (Fragment) |
| Sequence | LLRFVIPDVLKAFIVLGHYEDPKEDRSQKYDDRPLLIETVTAFGARERKPPHSQSDYQVFLKLSQYIARMVQSAPRISFQCFMEMLVTYEGLFETQCTVCQRVLSAEGSIPPVARVWRAREGAEGVWDPRHVTCLQN |
| Length | 137 |
| Position | Tail |
| Organism | Heterobasidion irregulare TC 32-1 |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Russulales> Bondarzewiaceae> Heterobasidion>
Heterobasidion annosum species complex.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.253 |
| Instability index | 37.02 |
| Isoelectric point | 7.01 |
| Molecular weight | 15818.03 |
| Publications | PubMed=22463738
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP33525
No repeats found
|