<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP33503
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MASLNISQEELKALEQTRQRLQQVSDSIGTLKNDVFSSNPLPNLASLQNSADILQATMRSLLTNMSNNDELFSRLAVHPSTNFPGRTQENILLQLLRKKPEPDVAASLDEGRKAYSELDESLKGEIKLEHRNNDEDDDDEDMSPMNQRWASLDAWVRKRAEKFIVDEFPEDFTAEELDLGIENVRTGLRRKFEYEEDDDDEDEDDEETKAVAPPKLHAEDDDVVMLDDLPPPPPPTVPSLQSQASQSGVATEHVDGLKLENMLKVATLGQLSR |
| Length | 273 |
| Position | Head |
| Organism | Pestalotiopsis fici (strain W106-1 / CGMCC3.15140) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Xylariomycetidae> Xylariales> Sporocadaceae> Pestalotiopsis.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.797 |
| Instability index | 60.28 |
| Isoelectric point | 4.36 |
| Molecular weight | 30724.54 |
| Publications | PubMed=25623211
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP33503
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 134.15| 42| 63| 97| 141| 1
---------------------------------------------------------------------------
97- 141 (68.05/39.80) RKK.........PEPDVAASLDEGrkaYSELDESLKGEIKLEHRNNDEDDDDED
157- 207 (66.10/32.70) RKRaekfivdefPEDFTAEELDLG...IENVRTGLRRKFEYEEDDDDEDEDDEE
---------------------------------------------------------------------------
|