| Description | Mediator of RNA polymerase II transcription subunit 11 |
| Sequence | MASQSSMDATSFAPFTTAERIQQLGEIDESIVSLLRTAGAAIQSLNKKDPNEGDGVMDLGNGGTDSDDEDDESGKDRAFKHQMNDFMRTLRSVNVRMKRQIWGLEEAGIIKSSDAPQGDAASDENGKTLEPDGNGKIGGMDVGWLNSRSNKVERDMESELWDQAEAFLKDMIKQGDDTKMTQ |
| Length | 182 |
| Position | Head |
| Organism | Pestalotiopsis fici (strain W106-1 / CGMCC3.15140) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Xylariomycetidae> Xylariales> Sporocadaceae> Pestalotiopsis. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.839 |
| Instability index | 40.39 |
| Isoelectric point | 4.42 |
| Molecular weight | 19924.67 |
| Publications | PubMed=25623211 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP33494
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.10| 27| 56| 91| 119| 1
---------------------------------------------------------------------------
91- 119 (39.45/31.94) RSVNVR..MKRQIWGLEEAgIIKSSdAPQGD
148- 176 (43.65/25.59) RSNKVErdMESELWDQAEA.FLKDM.IKQGD
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DVGWLNSR 2) KDRAFKH 3) KVERDMESELWDQAEAFLKDMIKQG | 141 75 151 | 148 81 175 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab